PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00041.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 356aa    MW: 40776.8 Da    PI: 7.8682
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00041.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.72e-52101401128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+ +yL+kkv++++++l ++i++vdiyk++PwdLp+k+  +ekewyfFs+rd+ky++g r+nra++sgyWkat
  Rsa1.0_00041.1_g00015.1  10 LPPGFRFHPTDEELILHYLRKKVSSSPVPL-SIIADVDIYKSDPWDLPAKAPFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKAT 94 
                              79****************************.89***************988899******************************** PP

                      NAM  87 gkdkevlsk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk + +      +e++g+kk Lvfy+g+ pkg+kt+W+mheyrl
  Rsa1.0_00041.1_g00015.1  95 GTDKLIAVPnregFNENIGIKKALVFYTGKPPKGVKTNWIMHEYRL 140
                              ******99855554556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-618186IPR003441NAC domain
PROSITE profilePS5100559.83710186IPR003441NAC domain
PfamPF023654.9E-2811140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MIRKDPRSSL PPGFRFHPTD EELILHYLRK KVSSSPVPLS IIADVDIYKS DPWDLPAKAP  60
FGEKEWYFFS PRDRKYPNGA RPNRAAASGY WKATGTDKLI AVPNREGFNE NIGIKKALVF  120
YTGKPPKGVK TNWIMHEYRL AESITPKRVT HARNGGQVNN LGDLNLKSKE YSMRLDDWVL  180
CRIYKKSHAS LSSAEVASAT SDDQEHEENG NEPFVVSEPL LPNDQTLKRQ KSSFSNLLDA  240
TDFTFLTNFL NETPENRTES DFSLMFGDFA NPDIYGNRYL DHKLPKLSSP TSETRVIGNK  300
RERLDYSEEM INTSKKMINN FSYNNSMDHL DHSMVQQSSF LNQEFLMSPP HLHYQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-71919016169NO APICAL MERISTEM PROTEIN
1ut4_B5e-71919016169NO APICAL MERISTEM PROTEIN
1ut7_A5e-71919016169NO APICAL MERISTEM PROTEIN
1ut7_B5e-71919016169NO APICAL MERISTEM PROTEIN
3swm_A6e-71919019172NAC domain-containing protein 19
3swm_B6e-71919019172NAC domain-containing protein 19
3swm_C6e-71919019172NAC domain-containing protein 19
3swm_D6e-71919019172NAC domain-containing protein 19
3swp_A6e-71919019172NAC domain-containing protein 19
3swp_B6e-71919019172NAC domain-containing protein 19
3swp_C6e-71919019172NAC domain-containing protein 19
3swp_D6e-71919019172NAC domain-containing protein 19
4dul_A5e-71919016169NAC domain-containing protein 19
4dul_B5e-71919016169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747600.0KF974760.1 Brassica napus NAC transcription factor 47-1 (NAC47-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303189.10.0NAC domain-containing protein 67-like
SwissprotD2SMN41e-79NAMB1_HORVS; NAC transcription factor NAM-B1
SwissprotQ8H4S41e-79NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA0A0C4MXK50.0A0A0C4MXK5_BRANA; NAC47-1.1 protein
STRINGBra040152.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77232540
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.10.0NAC domain containing protein 47